Protein Info for GFF1740 in Xanthobacter sp. DMC5

Annotation: Gamma-glutamylputrescine synthetase PuuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00120: Gln-synt_C
  • amino acids 135 to 466 (332 residues), 312.6 bits, E=1.7e-97

Best Hits

Swiss-Prot: 41% identical to PUUA_ECOLI: Gamma-glutamylputrescine synthetase PuuA (puuA) from Escherichia coli (strain K12)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 81% identity to xau:Xaut_2336)

MetaCyc: 41% identical to glutamate-putrescine ligase (Escherichia coli K-12 substr. MG1655)
Glutamate--putrescine ligase. [EC: 6.3.1.11]

Predicted SEED Role

"glutamine synthetase family protein" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of ammonia assimilation (plants) (3/3 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• ammonia assimilation cycle II (2/2 steps found)
• L-glutamine biosynthesis I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-aspartate degradation II (aerobic) (1/3 steps found)
• L-aspartate degradation III (anaerobic) (1/3 steps found)
• superpathway of ornithine degradation (4/8 steps found)
• putrescine degradation II (1/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.11 or 6.3.1.2

Protein Sequence (467 amino acids)

>GFF1740 Gamma-glutamylputrescine synthetase PuuA (Xanthobacter sp. DMC5)
MPVTLPGRRPDEASAAAEPADEVAAYLSTYGEPEVVEVLLPDTSAVLRGKWIPGRSITKI
WKDGVAIPLSIFGLDIWGCEVEATEIHLETGDKDGLCWPVAGTLKPVPWAPRPTAQVLIT
MHEPDGSAKGAPWKLDPRQQLAGIVDRFTARGLAPCVAFELEFYLLKPSDVPGAPPEPVF
PATGQARQNMYSMSDLDAFAPVLHDMRAACEQQGLPADTVISEAAPGQFEVNLYHRVDAL
AAADDAILLRRLIDGVARRHGLRASFMAKPLVDFAGNGMHVHVSLMETAGGNLFAKPDGV
GDRALRHAAGGLLATMAESTLLFVPSYNGYRRLVPGSYAPVSISWGYDNRSVAVRVPNGP
PAARRLEHRIAGAEAHPHLVLAGILAGMLEGLEREIEPPAPLSGNAYEHEAERLSPSMEE
AVRRFFASDFIARAFGEDYRRIYGVMKREELAAFTRQILPLEYDTYL