Protein Info for GFF174 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 42 to 59 (18 residues), see Phobius details TIGR01277: thiamine ABC transporter, ATP-binding protein" amino acids 2 to 214 (213 residues), 361.1 bits, see alignment E=9.1e-113 PF00005: ABC_tran" amino acids 18 to 157 (140 residues), 124.5 bits, see alignment E=5e-40 PF13304: AAA_21" amino acids 129 to 190 (62 residues), 27.1 bits, see alignment E=4.1e-10

Best Hits

Swiss-Prot: 100% identical to THIQ_SALTY: Thiamine import ATP-binding protein ThiQ (thiQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02062, thiamine transport system ATP-binding protein (inferred from 98% identity to spq:SPAB_00133)

MetaCyc: 85% identical to thiamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF174 Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLIAGFLAPASGTLLIAG
DDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNASQREKRDAIAHQMGIE
SLMTRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPALRQEMLTLVSDICRERQ
LTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELLSGQASASALLGIKSHIL