Protein Info for GFF1739 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Histone acetyltransferase HPA2 and related acetyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF13302: Acetyltransf_3" amino acids 57 to 175 (119 residues), 34 bits, see alignment E=4.5e-12 PF00583: Acetyltransf_1" amino acids 84 to 174 (91 residues), 38.3 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: None (inferred from 72% identity to pol:Bpro_4211)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>GFF1739 Histone acetyltransferase HPA2 and related acetyltransferases (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVDPTRWFKSTPLQAQAGVRASSSAGSGPEKGDKSSPVVVPIRSIGPGQIARIEAHLLEL
DSQDRYLRFGYAANDEQIRRYVAQLNFDRDELFGIFNRRLELIAMAHLAFSLDPKYNSCA
EFGVSVNKSARGRGYGGRLFERAVMHARNEGVHMLFIHALSENTAMLKIARRAGAVIERD
GSESEAHLRLPPADFDSRVTEIVNEQVAITDYHLKAQAKQFWGILSVLQEIRQGVREARE
RVRG