Protein Info for GFF1737 in Sphingobium sp. HT1-2

Annotation: Putative sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 44 to 61 (18 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 147 to 177 (31 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details PF01925: TauE" amino acids 9 to 256 (248 residues), 153.9 bits, see alignment E=3e-49

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 60% identity to bvi:Bcep1808_0782)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF1737 Putative sulfate permease (Sphingobium sp. HT1-2)
VTINPLYSLTGFIVGTLVGLTGVGGGSLMTPILVLLFNFHPAAAVGTDLLYACVTKSVGS
LVHGWKRSVDWAIVGWLALGSMPAAIGALMALKAMGPPSAAVVDPIKVTLGVMLFLTGLV
LLFRDRITAWSRTHGQDRSPATTRNLTILLGVVVGVAVTITSVGAGAIGATALLILYPRT
PLARIVGSDVAHAVPLTLVAGIGHWWLGTVDMSLLASLLIGSIPGIIVGSLLASHVREAV
LRTILATILIIVALNLIL