Protein Info for PS417_08830 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 75 to 100 (26 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 270 to 296 (27 residues), see Phobius details PF05661: DUF808" amino acids 4 to 291 (288 residues), 394.1 bits, see alignment E=1.9e-122

Best Hits

KEGG orthology group: K09781, hypothetical protein (inferred from 93% identity to pfs:PFLU1806)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U770 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PS417_08830 membrane protein (Pseudomonas simiae WCS417)
MAGSSLLVLIDDIAAVLDDVALMTKMAAKKTAGVLGDDLALNAQQVSGVRAEREIPVVWA
VAKGSFVNKLILVPTALLISAFAPWAVTPLLMLGGAYLCFEGFEKLAHKFLHSKVEDHAE
HAQLVKAVADPAIDLVAFEKDKIKGAIRTDFILSAEIIAITLGTVADAPLTQQVIVLSGI
AIVMTVGVYGLVAGIVKLDDLGLWLTQKPGQAARSIGGAILRAAPYMMKSLSVIGTAAMF
LVGGGILTHGLPVVHHWIETVSQSAGGVAWLVPTLLNGVAGIIAGAVVLAVVSGVGKLWN
TAKA