Protein Info for GFF1734 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Histidinol-phosphatase (EC 3.1.3.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 2 to 143 (142 residues), 130.9 bits, see alignment E=3.5e-42 TIGR01662: HAD hydrolase, family IIIA" amino acids 2 to 143 (142 residues), 95.6 bits, see alignment E=2.8e-31 PF08645: PNK3P" amino acids 3 to 110 (108 residues), 25.6 bits, see alignment E=1.4e-09 PF13242: Hydrolase_like" amino acids 99 to 151 (53 residues), 24.6 bits, see alignment E=2.9e-09

Best Hits

Swiss-Prot: 45% identical to GMHBB_PSEAE: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 65% identity to pol:Bpro_4201)

Predicted SEED Role

"Histidinol-phosphatase (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>GFF1734 Histidinol-phosphatase (EC 3.1.3.15) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKLLILDRDGTLNRSRDDYVASPDEWEALPGALEAVARLNQGGWRIVLATNQSGIGRGLF
DMASLNAIHAKMHRQLAAAGARVEAIFMCPHAPEDLCACRKPAPGLFLQVGARFGVPLAN
VHAAGNAMRHVRAAAAAGCRTHLLMTGKSEHLRGRVGSGAPVDLAALAPDLPPGTHPHDD
LGAFADWLLAQPTT