Protein Info for GFF1733 in Xanthobacter sp. DMC5

Annotation: UvrABC system protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 786 TIGR00194: excinuclease ABC subunit C" amino acids 96 to 544 (449 residues), 414.4 bits, see alignment E=4.4e-128 PF01541: GIY-YIG" amino acids 106 to 178 (73 residues), 28 bits, see alignment E=8.8e-10 PF27096: UvrC_M" amino acids 189 to 285 (97 residues), 91.4 bits, see alignment E=1.8e-29 PF02151: UVR" amino acids 295 to 325 (31 residues), 35 bits, see alignment (E = 3.5e-12) PF22920: UvrC_RNaseH" amino acids 339 to 452 (114 residues), 139.8 bits, see alignment E=1.6e-44 PF08459: UvrC_RNaseH_dom" amino acids 470 to 714 (245 residues), 181.9 bits, see alignment E=3.2e-57 PF14520: HHH_5" amino acids 730 to 778 (49 residues), 36.7 bits, see alignment 1.9e-12 PF12826: HHH_2" amino acids 733 to 782 (50 residues), 36.3 bits, see alignment 2.1e-12

Best Hits

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (786 amino acids)

>GFF1733 UvrABC system protein C (Xanthobacter sp. DMC5)
MSLWLTSGENRRPAAPFPPGAGRITYASMTRRRPADPAEIALARADGGAPSEALPPGAGE
GTAEETEEAVLLELEPSDETLPGEESLATGRAAIIRAVKHAPNGPGVYRMIAADGTVLYV
GKAKSIKKRVLSYTRPVGHTNRIARMIAGTAQMEFVSTRTEPEALLLEANLIKQLKPRFN
VLLRDDKSFPYILITADHVSPQIAKHRGARNRPGDYYGPFASVWAVDRTINALERAFLLR
SCSDSYYENRTRPCLLFQIKRCAGPCTGEVSHQDYAELVREARAFLSGRSRAIKEELAKE
MEQAAEELEFERAARLRDRLAALSAVQGSQGINPRGVEEADVFACHQQGGATCVEVFFFR
TGQNWGNRAYYPRADRSLTEAEVLGAFLAQFYEDKPCPRLLLLSHKVEEQELLADALSEK
AGYRVEIAVPQRGEKRDLVDHALQNAREALARTLAESATQAKLLEGVAATFGLKAPPQRI
EVYDNSHIMGTNAVGGMIVAGPEGFRKSQYRKFNIKSADLVPGDDFGMMREVLTRRFARL
LKEAPRENAPSASEAVPPSPPPSPAREEGVPDVMGGDTEDHPAPIEAAAGTEASPEPALA
LGGEVRGDDPSAAPPAEPEMEDEPDAIPDATGASPWPDLVLIDGGLGQLNAARKVLEELG
ITDVPLVGIAKGLDREAGREQFFLPGRTPFRMEPRDPVLYYIQRLRDEAHRFAIGSHRAR
RKKDITEAGLQAIPGVGPTRKRALLRHFGTLKAIERASLADLEQVAGINAGTAKAVYDYF
HERPSS