Protein Info for PS417_08800 in Pseudomonas simiae WCS417

Annotation: tartronate semialdehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF03446: NAD_binding_2" amino acids 3 to 162 (160 residues), 183.7 bits, see alignment E=6.7e-58 TIGR01505: 2-hydroxy-3-oxopropionate reductase" amino acids 3 to 291 (289 residues), 390.7 bits, see alignment E=1.9e-121 PF07991: KARI_N" amino acids 3 to 71 (69 residues), 24.5 bits, see alignment E=4.5e-09 PF03807: F420_oxidored" amino acids 3 to 95 (93 residues), 38.3 bits, see alignment E=4.3e-13 PF14833: NAD_binding_11" amino acids 165 to 283 (119 residues), 133 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 64% identical to GLXR_ECOLI: 2-hydroxy-3-oxopropionate reductase (glxR) from Escherichia coli (strain K12)

KEGG orthology group: K00042, 2-hydroxy-3-oxopropionate reductase [EC: 1.1.1.60] (inferred from 99% identity to pfs:PFLU1801)

MetaCyc: 64% identical to tartronate semialdehyde reductase 2 (Escherichia coli K-12 substr. MG1655)
1.1.1.60,4.1.1.M27,4.1.1.73 [EC: 1.1.1.60, 4.1.1.73, 4.1.1.M27]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.60 or 4.1.1.73 or 4.1.1.M27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCT2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>PS417_08800 tartronate semialdehyde reductase (Pseudomonas simiae WCS417)
MAKIGFIGTGIMGQPMAANLQKAGHQLFLSEHHGKAAQALVDAGAVALANPQQVAQEAEF
IIVMVPDTPQVDDVLFRKDGVAAGLSPNKVVIDMSSISPTATKAFAAKINETGAQYLDAP
VSGGEVGAKAGTLSIMIGGEPQTFERALPLFQAMGKNITLVGGNGDGQTAKVANQIIVAL
NIQAVAEALLFASKNGADPAKVREALMGGFASSKILEVHGERMIKGTFDPGFRINLHQKD
LNLALAGAKELGINLPNTAGTQQVFSTCTAIGGGNWDHSALIKGLEHMANFSIRDK