Protein Info for PS417_08790 in Pseudomonas simiae WCS417

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 5 to 322 (318 residues), 370.4 bits, E=8.1e-115
• TIGR01064: pyruvate kinase
  • amino acids 5 to 469 (465 residues), 504.7 bits, E=1.1e-155
• PF02887: PK_C
  • amino acids 355 to 467 (113 residues), 96.8 bits, E=9.3e-32

Best Hits

Swiss-Prot: 49% identical to KPYK1_AGRVI: Pyruvate kinase (ttuE) from Agrobacterium vitis

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 98% identity to pfs:PFLU1799)

MetaCyc: 40% identical to pyruvate kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyruvate kinase. [EC: 2.7.1.40]

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• Bifidobacterium shunt (12/15 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• heterolactic fermentation (14/18 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.40

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

See A0A1N7U468 at UniProt or InterPro

Protein Sequence (471 amino acids)

>PS417_08790 pyruvate kinase (Pseudomonas simiae WCS417)
MTPDKKVKILATLGPATDGIDDIRELVEAGVNIFRLNFSHGDHADHAQRYQWIRQVERQL
NYPLGILMDLQGPKLRVGRFVEGKVQLVRGQALRLDLDETPGDQRRINLPHPEIIAALEP
GMDLLLDDGKLRLRVITKHADAIDTTVLNGGELSDRKGVNVPQALLELSPLTAKDRRDLS
FGLELGVDWVALSFVQRPEDIREARELIGDKAFLMAKIEKPSAVQRLQEIAELSDAIMVA
RGDLGVEVPAESVPQIQKDIISTCRQLGKPVVVATQMLESMRFSPAPTRAEVTDVANAVA
EGADAVMLSAETASGEYPLEAVQMMSKIIRQVENGPDYQAQLDVSRPKADATVSDAISCA
IRRISSILPVAVLVNYSESGSSSLRAARERPVSPILNLTPNLSTARRLSVAWGVHSVVND
RLRQVDEVCSTALEIAQAQGMAERGDTLVITAGVPFGQPGSTNSLRIETLI