Protein Info for GFF1728 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details PF01027: Bax1-I" amino acids 19 to 231 (213 residues), 122.3 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: K06890, (no description) (inferred from 99% identity to sew:SeSA_A4073)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>GFF1728 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSFQPSFAGPQPDSRIDRTTFIRRAYLHLAVAIVGFIVLSAAWSFIGVGEYALDVLLAGG
RYSWLVVLGAFMLVGMLATRLADNAGNNQTQLIGLGIYVLAESLIFAPLLTVAAYINPSS
IGAAAITTLLLVGGLTFTAFSIKKDFSFLRSFLTMAGFIAFGAIIASVICGFSLGVWFSA
LMVLLCAGFILYDTSNIIHHYPTDRPAGAALHLFASIATMFWYILRIFMSRN