Protein Info for PS417_08785 in Pseudomonas simiae WCS417

Annotation: urea transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 27 to 57 (31 residues), see Phobius details amino acids 75 to 110 (36 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details PF03253: UT" amino acids 11 to 272 (262 residues), 168 bits, see alignment E=1.4e-53

Best Hits

KEGG orthology group: K08717, urea transporter (inferred from 88% identity to pfs:PFLU1798)

Predicted SEED Role

"Eukaryotic-type low-affinity urea transporter" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXK5 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PS417_08785 urea transporter (Pseudomonas simiae WCS417)
MHNPTCPDWAEALLNGFSQIFLQRQPLCGLLCLLAILIGAPTLLGGALLGGLAGLLTAQR
RGYPKAERQAGLYSYNGVLLGLLISQHFAWSAVLPPLILACGGLSAILTRQWLKRATQPS
DLPAYTAPFVGLGWLLLGTVPERAFALNVPDASAIFTAPFTGLAQIMLLDQPVAGALIAL
GLWLANRRAATWALIGASVGVLIALWLDEPATALLGLHSYNPALAAVALSQIRRQPWLPL
LGILLAITLTPGFAALHLPALTAPFILACWLVRAGARVLRKPRMDRPFESP