Protein Info for GFF1719 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 847 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 127 to 152 (26 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 238 to 274 (37 residues), see Phobius details amino acids 282 to 307 (26 residues), see Phobius details amino acids 326 to 352 (27 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details amino acids 454 to 476 (23 residues), see Phobius details amino acids 496 to 517 (22 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 18 to 299 (282 residues), 34.8 bits, see alignment E=1.3e-12 PF09924: LPG_synthase_C" amino acids 542 to 827 (286 residues), 312.7 bits, see alignment E=2.3e-97

Best Hits

KEGG orthology group: K14205, phosphatidylglycerol lysyltransferase [EC: 2.3.2.3] (inferred from 56% identity to npp:PP1Y_Mpl1848)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (847 amino acids)

>GFF1719 hypothetical protein (Sphingobium sp. HT1-2)
MGAMTYLRRYQTPLSVGLVVLLAALGFVALYHLLHDVHVRDIRAAFHALGPAALVPALLL
TAISYVTLTFYDVLALRSIGRPLPYGMAALASFTSYTLSHNLGLSLLTGGSARYRIYSAA
GLGVADVARVVAIAGATFWGGVLTLAAAMLVWRPETLSMGDIRLSAPALRVAGSLTLTAI
IGLILFAGRQGRMLHFGRMSLPLPPASRIFCQIGIGVIDLAAASAALFVLVPGVGLHAWP
AFFLGYALAIVAVLLTHVPGGVGVFELVMLAALPGVDRPQLVAALLAYRLVYYILPLLIA
VGIIVAQEGWRWRQPLRRTLRGLQAVTTGLAPIMTAALVFLGGAILLVSGSLPAIPHRVA
TLNSVVPLPFLEASHMAGSLVGAALLILSAGLYRRLDGAFWLTRILLLAGAIFSLLKGLD
YEEAAAMLLIAALLQWARPAFYRRTQLIADAFTPGWLATVAVVLGLCVWIGFFAYKHVEY
QNDLWWHFAARADASRFLRASLAVAVLLIGVALWRLLRPAATIPALASNAAVPPEAALAL
AERTDANLAYIGDKRFLVSDGGTCCLMYQIRGHSWIVMGDPVGARSEWADLLWRLREQAD
AAQGRLLLYQISQDMLPLAIELGLQIVKYGEEAHVDLAGFTLDGPDAKPLRYAERRAARE
GASFEIIPAAMLDKEMDRLAEISANWLQAKGHKEKCFSVGRFDRAYMARFDCAVVRQEGR
IVAFANIWAAADQSELSVDLMRHDDGAPYGTMDFLFIHLMLWGKAHGYRWFNLGLAPLSG
LEARRLAPLWSKLGALLYQHGNALYGFEGLRAYKDKFGPEWEPRFVAGPQGLSFGRALLD
LQALIAG