Protein Info for GFF1718 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glutathione S-transferase (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF02798: GST_N" amino acids 21 to 98 (78 residues), 46 bits, see alignment E=1.6e-15 PF13417: GST_N_3" amino acids 23 to 100 (78 residues), 36.4 bits, see alignment E=1.6e-12 PF13409: GST_N_2" amino acids 29 to 98 (70 residues), 44.6 bits, see alignment E=5.4e-15 PF00043: GST_C" amino acids 143 to 222 (80 residues), 37.3 bits, see alignment E=7.8e-13 PF14497: GST_C_3" amino acids 150 to 225 (76 residues), 28.1 bits, see alignment E=5.7e-10 PF13410: GST_C_2" amino acids 151 to 217 (67 residues), 31.8 bits, see alignment E=3.9e-11

Best Hits

KEGG orthology group: K11209, GST-like protein (inferred from 81% identity to cvi:CV_2745)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>GFF1718 Glutathione S-transferase (EC 2.5.1.18) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSTLDTFAITQKWPAAHPDRLQLYSLPTPNGVKVSIMLEETGLPYEPHLVSFDTNDQLSP
AFLSLNPNNKIPAILDPNGPDGRPLALWESGAILVYLAGKTGRFLPDDAAGKYETLQWLM
FQMGGVGPMFGQLGFFHRFAGKEYEDKRPRDRYVNESKRLLKVLNERMEGRAWLMGDAYT
IADIATWPWVRNLVGFYGAGEIVGFGDFPNLKRVLEAFEQRPAVQRGLKIPVRG