Protein Info for GFF1714 in Sphingobium sp. HT1-2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 44 to 70 (27 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 114 to 140 (27 residues), see Phobius details amino acids 171 to 208 (38 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details PF01925: TauE" amino acids 18 to 287 (270 residues), 152.3 bits, see alignment E=9.5e-49

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 95% identity to sch:Sphch_0121)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF1714 putative membrane protein (Sphingobium sp. HT1-2)
MDLYLPIANLSVNALVIIGLGGVVGLLSGMFGVGGGFLTTPLLIFYGIPPTVAAASAASQ
VTGASVSGVVTHMSRGTVDFRMGGVLIAGGVVGAGLGVLIFRLLQSLGQIDTVIGILYVL
MLGGIGSLMAKESIQALIALKTGKRMQARKRRHHPLVAALPMRWRFYRSGLYISPLAPLL
LGMATGILTMLLGVGGGFILVPAMLYLLGMNTQSVVGTSLFQILFVTMATTMMHAMTTKA
VDLVLAMLLLIGSVTGAQVGTRLSMTIRPEYLRILLAAIVLLVAARMALGLGWRPDEIFT
IDVK