Protein Info for PS417_08715 in Pseudomonas simiae WCS417

Annotation: cytochrome C biogenesis protein CcmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 255 to 271 (17 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 426 to 448 (23 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details amino acids 621 to 639 (19 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 58 to 644 (587 residues), 781.8 bits, see alignment E=2.6e-239 PF01578: Cytochrom_C_asm" amino acids 94 to 301 (208 residues), 189.1 bits, see alignment E=8.6e-60 PF16327: CcmF_C" amino acids 321 to 641 (321 residues), 405.8 bits, see alignment E=1.4e-125

Best Hits

Swiss-Prot: 95% identical to CCMF_PSEFL: Cytochrome c-type biogenesis protein CcmF (ccmF) from Pseudomonas fluorescens

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 98% identity to pfs:PFLU1763)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9D6 at UniProt or InterPro

Protein Sequence (662 amino acids)

>PS417_08715 cytochrome C biogenesis protein CcmF (Pseudomonas simiae WCS417)
MTSALFIPELGQLAMILALCFAIVQAVVPLLGAWRGDRLWMSLAQPAAWGQFAFLLFAFG
CLTYAFMTDDFSVAYVANNSNTALPWYYKFSAVWGAHEGSLLLWALILGGWTFAVSVFSR
QLPQVMLARVLAVMGMISIGFLLFLIMTSNPFSRILPQIPADGHDLNPLLQDIGLIVHPP
MLYMGYVGFSVAFAFAIAALLGGRLDAAWARWSRPWTIVAWAFLGIGITLGSWWAYYELG
WGGWWFWDPVENASFMPWLVGTALIHSLAVTEKRGVFKSWTVLLAIAAFSLSLLGTFLVR
SGVLTSVHAFASDPERGVFILIFLLFVVGGSLTLFALRAPVVKSRVGFNLWSRETLLLGN
NLVLVVAASMILLGTLYPLVLDALSGAKLSVGPPYFNALFIPLMGLLMVVMAVGVLVRWK
DTPVKWLVGMLMPVLLGSVALAVIAWVAYGDFNWAVLATFLLAAWVLLAGVRDIFDKTRH
KGLIKGLPTLTRSYWGMQIAHIGIAVCALGVVLSSQNSAERDLRLAPGESMDLAGYHFIF
EGAKHFEGPNFTSDKGTVRVVRNGKEIAVLHPEKRLYTVQSSMMTEAGIDAGFTRDLYVA
LGEPLGDGAWAVRVHVKPFVRWIWFGGLLTGFGGLLAALDRRYRVKVKSRVREALGLQGA
AV