Protein Info for PS417_08710 in Pseudomonas simiae WCS417

Annotation: cytochrome C biogenesis protein CcmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 99% identical to CCME_PSEFS: Cytochrome c-type biogenesis protein CcmE (ccmE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 99% identity to pfs:PFLU1762)

MetaCyc: 51% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

cytochrome c biogenesis (system I type) (7/11 steps found)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TW33 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PS417_08710 cytochrome C biogenesis protein CcmE (Pseudomonas simiae WCS417)
MNPLRRKRLLIILAILAGVGIAVGLALSALQQNINLFYTPTQIANGEAPVDTRIRAGGMV
EKGSLKRSGDSLDVTFVVTDFNKAVTITYRGILPDLFREGQGIVALGKLNADGVVVADEV
LAKHDEKYMPPEVTKALKDSGQSAPTPAKEG