Protein Info for GFF1708 in Xanthobacter sp. DMC5

Annotation: NADH:FAD oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01613: Flavin_Reduct
  • amino acids 19 to 168 (150 residues), 150 bits, E=2.9e-48

Best Hits

Swiss-Prot: 44% identical to RUTF1_METEP: FMN reductase (NADH) RutF 1 (rutF1) from Methylobacterium extorquens (strain PA1)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 82% identity to xau:Xaut_2575)

MetaCyc: 35% identical to cob(II)yrinate a,c-diamide reductase monomer (Brucella melitensis)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (26/33 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (7/8 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (24/36 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 2.5.1.17

Use Curated BLAST to search for 1.5.1.- or 2.5.1.17

Protein Sequence (171 amino acids)

>GFF1708 NADH:FAD oxidoreductase (Xanthobacter sp. DMC5)
MSAAAEIFSVDAGLFRDAMRRMASGVAVIATDGPAGRAGLTVSSLASLCMEPPSVILCIH
EQSNALKVIEANGVFVANVLAHHQSHVSDTFAGQVPQFRDDKFACAEWRAAQSGAPVLDG
ALMSFDCRLATHHAYGTHRIVVGAVTAVHGLEDEAEPLLYANRAYRRLTAA