Protein Info for GFF1708 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details PF01810: LysE" amino acids 16 to 208 (193 residues), 119.7 bits, see alignment E=5.8e-39

Best Hits

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 63% identity to rsl:RPSI07_3074)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>GFF1708 Homoserine/homoserine lactone efflux protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MELQFWMAYFVASWAIALSPGSGAVLSMTHGLAYGVKKTSVTIAGLQLGLAVILLVAGVG
VGALLLASATAFTVVKFAGAGYLIWLGFNQWRARVGVVPEADGAAPARVAVPSVRERFVM
GFFTNVTNPKGIVFMVAVLPQFIDPRRGLWLQLLILLATTVVVDLIVMHGYAFLASRAQR
WLATARARRAQNRVFGGVLMAMGASLLLVKRAA