Protein Info for GFF1701 in Xanthobacter sp. DMC5

Annotation: Acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 105 to 122 (18 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 7 to 376 (370 residues), 361.8 bits, see alignment E=2e-112 PF01546: Peptidase_M20" amino acids 67 to 378 (312 residues), 111 bits, see alignment E=7.8e-36 PF07687: M20_dimer" amino acids 171 to 277 (107 residues), 78.5 bits, see alignment E=3.6e-26

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 82% identity to xau:Xaut_2582)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.16

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF1701 Acetylornithine deacetylase (Xanthobacter sp. DMC5)
MQVSTEEILEKIISVPSVTDTENGEIVARIAEIAAPFARVRHLPNAAGDRAALLLSIGPE
ERPGVVLSAHTDVVAVEGQPWTSDPFALTARGDRLYGRGTSDMKGFVACVLAALPAFAAA
ALETPVHVALSYDEEIGCKGAGDLVALLAALPMPPLLCIVGEPTGMKVKRAHKGKTGWRV
TATGRTGHSALPHRAANAVTALARLAARLADLADDLRGGARDEAFDPPYATLHIGSLHGG
GALNVVPDRAVMEFELRSIPGADTPTILRRIEVLVAEARAALKAEAEEADLVVEELSSYP
ALATAAGSAEAAAVARLCGDNGPPGTIAFGTEAGLYSEAGIPTLVCGPGDIARAHKADEW
VGRDELAQCDAMLARLAELLRRPAADWITP