Protein Info for GFF170 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: DNA-3-methyladenine glycosylase (EC 3.2.2.20)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 158 to 178 (21 residues), see Phobius details PF03352: Adenine_glyco" amino acids 16 to 186 (171 residues), 232.4 bits, see alignment E=1.6e-73

Best Hits

KEGG orthology group: K01246, DNA-3-methyladenine glycosylase I [EC: 3.2.2.20] (inferred from 70% identity to sil:SPO1900)

Predicted SEED Role

"DNA-3-methyladenine glycosylase (EC 3.2.2.20)" in subsystem DNA Repair Base Excision (EC 3.2.2.20)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>GFF170 DNA-3-methyladenine glycosylase (EC 3.2.2.20) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTTVDGPDGQPRCRWCAAAPEFFAYHDREWGFPVDDDRRLFEKLCLESFQSGLSWRTIL
AKRENFRAAFHGFDFNRVARFTPKDVERLLGDEGIVRHRGKIEAVINNAQRAQAMVKAEG
SLAAFFWRYEPDEAELGEPQTVSTSEASVRLSKDLKKLGWAFVGPTTVFAFMQAMGLIND
HAEACVVRAQAAQARRRFKRP