Protein Info for GFF1697 in Xanthobacter sp. DMC5

Annotation: Aromatic amino acid exporter YddG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF00892: EamA" amino acids 10 to 135 (126 residues), 49.1 bits, see alignment E=3.5e-17 amino acids 150 to 281 (132 residues), 50.7 bits, see alignment E=1.2e-17

Best Hits

KEGG orthology group: None (inferred from 90% identity to xau:Xaut_2587)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF1697 Aromatic amino acid exporter YddG (Xanthobacter sp. DMC5)
MSSVTATRIGFLAILLWATLAFFTAATGKVPPFLLTALTFGIGGAVGLGAALAGPGLGVL
RQRPLAYLHGVGGLFGYHFLYFTALKLAPAAEAGLIAYLWPLLIVLLSAFLPGGGLRRVH
VIGALMGFAGTVVLLAGKGGFSGIEMRFLPGYLAAFACAFIWSSYSVASRHFADVPTQAV
AGFCLATAVLAALCHIAWEETVWPASAGEWTAVVLLGIGPVGLAFYTWDIGMKRGDVRLL
GVASYAAPVLSTLLLVATGFSAPSLSLAVACALIVGGAFVATRR