Protein Info for GFF1692 in Xanthobacter sp. DMC5

Annotation: putative GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00750: LAO/AO transport system ATPase" amino acids 28 to 288 (261 residues), 245.6 bits, see alignment E=3.2e-77 PF03308: MeaB" amino acids 34 to 289 (256 residues), 250.1 bits, see alignment E=3.1e-78 PF02492: cobW" amino acids 64 to 217 (154 residues), 22.9 bits, see alignment E=8.7e-09

Best Hits

KEGG orthology group: K07588, LAO/AO transport system kinase [EC: 2.7.-.-] (inferred from 84% identity to xau:Xaut_2592)

Predicted SEED Role

"putative periplasmic protein kinase ArgK and related GTPases of G3E family"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF1692 putative GTPase (Xanthobacter sp. DMC5)
MPPEPASVDAPDRPRTSPVPDLATLAAGGKRAVARALALVETARGKPDLVALLDAAARAG
KAEVLGLTGPPGVGKSTLTNALVRRARAAGRTVAVLAVDPSSRRTGGALLGDRARMKTDP
DDRGVFVRSMAARDRLGGLSDDSVAAVVLLRAVYDLVIVETVGVGQSEADISLVADTVVL
CIQPASGDSLQFMKAGVMELPDIIVVTKADMAEVARRAASEVAGALSLAGSASVGWTVPV
IRLSAATGEGLDAFEAAVAAHGAFLDTENRRAAQRAAQEDKWVEEAVRVRFGTHGLARAR
KFQLRGQGPFAREAELALKLTSRQD