Protein Info for GFF1690 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF02622: DUF179" amino acids 26 to 192 (167 residues), 164 bits, see alignment E=1.4e-52

Best Hits

Swiss-Prot: 88% identical to Y2594_XANP2: UPF0301 protein Xaut_2594 (Xaut_2594) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 88% identity to xau:Xaut_2594)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>GFF1690 hypothetical protein (Xanthobacter sp. DMC5)
MTASQNQTIEGGGSGFLDGQMLIAMPTMRDEQFARTLVYMCAHSPEGAMGIVVNQPASHI
DFTDLLVQLDVVPASERILLPKSAGTVKVLRGGPVETGRGFVLHSADYFVENSTLTIDDG
ICLTATLDILKAIAGGRGPRSAVLALGYAGWAPGQLETEIQANGWLNCPADPDLIFGAGV
ETKYDSALRKLGIVPGMLSSDAGHA