Protein Info for GFF1690 in Sphingobium sp. HT1-2

Annotation: Two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details PF06580: His_kinase" amino acids 174 to 254 (81 residues), 87.6 bits, see alignment E=5.2e-29 PF02518: HATPase_c" amino acids 273 to 365 (93 residues), 38.2 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 79% identity to sch:Sphch_0142)

Predicted SEED Role

"Two-component signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>GFF1690 Two-component system sensor histidine kinase (Sphingobium sp. HT1-2)
MTLPTEEGPRGVSPTAALYSIIGFWFFYAILISVRALVVGFDYQGEMAARRAVVTLIGII
VTWILYLAIRRFDAKPLAVRIVAAFSLAAPFALAMAVANYYVFNIYDPMGMFPDMDQQKY
EAQSHALIYIVDDAVSRYFFLSAWAGLYLGLSYASEAHRTERRAARLERAAQQAELRSLR
YQVNPHFLFNTLNSLSSLVMKDRRDEAEQMIMSLSNFYRTSLTGDPLDDVQLEEEVHLQK
LYLDIEAVRFPDRLATRIDIPADLLTACVPGLILQPLVENAIKYGVSRTSSPVAITIRAR
EEHGLLHLTVADNGDKPPSAGDGGSGIGLANVRDRLSARFGDQGRIDYGPQADGGFAVNL
FLPLNRRGC