Protein Info for GFF1683 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Tyrosine-specific transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 22 to 409 (388 residues), 466.4 bits, see alignment E=9e-144 TIGR00837: aromatic amino acid transport protein" amino acids 26 to 403 (378 residues), 466.4 bits, see alignment E=4.3e-144 PF01490: Aa_trans" amino acids 27 to 226 (200 residues), 34.1 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 89% identical to TYRP_ECOLI: Tyrosine-specific transport protein (tyrP) from Escherichia coli (strain K12)

KEGG orthology group: K03834, tyrosine-specific transport protein (inferred from 100% identity to sei:SPC_1775)

Predicted SEED Role

"Tyrosine-specific transport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF1683 Tyrosine-specific transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPYPAPRISPFFVTGVVESVKNRTLGSIFIVAGTTIGAGMLAMPLAAAGVGFSVTLGLLI
GLWALMCYTALLLLEVYQHVPADTGLGSLAKRYLGRYGQWLTGFSMMFLMYALTAAYISG
AGELLASSINNWLGATLSPAAGVLLFTFVAGGVVCVGTSLVDLFNRFLFSAKIIFLVIML
ALLTPHIHKVNLLTLPLQQGLALSAIPVIFTSFGFHGSVPSIVSYMNGNIRRLRWVFMTG
SAIPLVAYIFWQLATLGSIDSPTFRGLLASHAGLNGLLQALREVVASPHVELAVHLFADL
ALATSFLGVALGLFDYLADLFQRRSTVSGRLQTGLITFLPPLAFALFYPRGFVMALGYAG
VALAVLALLIPAMLVWQCRKQSPQAGYRVAGGTPALALVFICGIVVIGVQFSIALGFLPD
PG