Protein Info for PS417_08555 in Pseudomonas simiae WCS417
Annotation: protease HtpX
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to HTPX_PSEFS: Protease HtpX (htpX) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 99% identity to pfs:PFLU1730)Predicted SEED Role
"Probable protease htpX homolog (EC 3.4.24.-)" (EC 3.4.24.-)
Isozymes
Compare fitness of predicted isozymes for: 3.4.24.-
Use Curated BLAST to search for 3.4.24.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UIE8 at UniProt or InterPro
Protein Sequence (295 amino acids)
>PS417_08555 protease HtpX (Pseudomonas simiae WCS417) MMRILLFLATNLAVVLIASITLSLFGFNGFMAANGVDLNLNQLLIFCAVFGFAGSLFSLF ISKWMAKMSTSTQVITQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWN KNDALVAVSQGMLERFSYDEVKAVLAHEIGHVANGDMVTLALVQGVVNTFVMFFARIIGN FVDKVIFKNEGGRGIAYFVATIFAELVLGFLASAITMWFSRKREFRADEAGARLAGTGAM IAALQHLRSEQGLPVHMPDSLTAFGINGGIKQGMARLFMSHPPLEERIDALRRMG