Protein Info for GFF1681 in Sphingobium sp. HT1-2

Annotation: Hydrolase SMc00528, alpha/beta fold family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 101 to 119 (19 residues), see Phobius details PF02129: Peptidase_S15" amino acids 22 to 138 (117 residues), 47.8 bits, see alignment E=4.9e-16 PF20408: Abhydrolase_11" amino acids 29 to 194 (166 residues), 28 bits, see alignment E=5.2e-10 PF12146: Hydrolase_4" amino acids 46 to 134 (89 residues), 37.5 bits, see alignment E=4.9e-13 PF00561: Abhydrolase_1" amino acids 49 to 143 (95 residues), 35.7 bits, see alignment E=2.3e-12 PF12697: Abhydrolase_6" amino acids 54 to 135 (82 residues), 26.7 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 53% identical to Y471_RICPR: Uncharacterized protein RP471 (RP471) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K07018, (no description) (inferred from 99% identity to sjp:SJA_C1-21760)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF1681 Hydrolase SMc00528, alpha/beta fold family (Sphingobium sp. HT1-2)
MPDVIFPGPEGRLEGRFSPPPRPRAPVAMILHPHPQGGGTMNDRITQALYKTFVKRGFAV
LRFNFRGVGRSQGTFDNGIGELSDAAAALDWVQSFHPEAQTTWIAGFSFGAWIGMQLLMR
RPEIRGFISVAPPANMYDFSFLAPCPSSGIIVQGTADEVVTASAVQKLVDKLRTQKGITI
HHDEIKGANHFFEHELDQLMKSVDNYLDMRLSPDSPIR