Protein Info for PS417_08550 in Pseudomonas simiae WCS417

Annotation: thiopurine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF05724: TPMT" amino acids 1 to 216 (216 residues), 283.8 bits, see alignment E=4.7e-89 TIGR03840: thiopurine S-methyltransferase, Se/Te detoxification family" amino acids 4 to 215 (212 residues), 290.6 bits, see alignment E=3.2e-91

Best Hits

Swiss-Prot: 83% identical to TPMT_PSEFS: Thiopurine S-methyltransferase (tpm) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00569, thiopurine S-methyltransferase [EC: 2.1.1.67] (inferred from 83% identity to pfs:PFLU1728)

Predicted SEED Role

"Thiopurine S-methyltransferase (EC 2.1.1.67)" (EC 2.1.1.67)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.67

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCN1 at UniProt or InterPro

Protein Sequence (218 amino acids)

>PS417_08550 thiopurine S-methyltransferase (Pseudomonas simiae WCS417)
MEPEFWQERWARNQIGFHLPEVNPYLQRHWSQLALVEGARVLVPLCGKSLDLMWLASHGL
RVMGVELSEQAVEAFFSEQNLVPRITRRDAFTVYQTDLIEVWCGDFFALDAEALAGCTAL
YDRAALIALPPLMRAQYAEHLSRLLPSGCQGLLITLDYDQSQKAGPPFAVTDDEVKVLFG
SDWTVKTLQEQDVLGESWKFVQEGVTRLDERVYWLGRA