Protein Info for GFF1679 in Sphingobium sp. HT1-2

Annotation: Cysteine desulfurase (EC 2.8.1.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 41% identical to ISCS_METCA: Cysteine desulfurase IscS (iscS) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K04487, cysteine desulfurase [EC: 2.8.1.7] (inferred from 80% identity to sch:Sphch_0632)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

superpathway of L-alanine biosynthesis (4/4 steps found)
L-alanine biosynthesis III (1/1 steps found)
L-cysteine degradation IV (1/1 steps found)
cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
molybdopterin biosynthesis (3/6 steps found)
tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
thiazole component of thiamine diphosphate biosynthesis II (3/7 steps found)
thiazole component of thiamine diphosphate biosynthesis I (2/6 steps found)
tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
[2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
tRNA-uridine 2-thiolation and selenation (bacteria) (2/11 steps found)

KEGG Metabolic Maps

Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>GFF1679 Cysteine desulfurase (EC 2.8.1.7) (Sphingobium sp. HT1-2)
VIYLDYQATTPLAPEAFETMVPLLRDQFANPHSAHRAGRMVAAQVELARDAIGQLLPPGG
RLLFTSGATEALNIAIQGAPAGDIVTIATEHAAVLDTVAAMRRTGRAVTVLPVDGDGLVD
LDVAARAIVPGVALVVAMLVNNEIGVIQPVGALAELAHGAGALFLCDAVQGYGRVPIPDP
CDMVAISAHKIHGPKGIGALWLRDGVKIDPLIHGGGQEGGLRSGTLSPALCAGFGVAARL
MREQAEADQAHVAALSAQARALFADWTLNGSADARYPGNLNIRRAGIDGARLLSDCRNVS
FSLGSACASGSGRPSHVLRALGLSDSQARGSVRIGFGRYTTSAELEEAAKVINGAATAQA
AP