Protein Info for GFF1675 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 30 to 53 (24 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 114 to 140 (27 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 248 to 273 (26 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 30 to 300 (271 residues), 134.9 bits, see alignment E=1.5e-43

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 89% identity to vpe:Varpa_0818)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF1675 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MSAGHKQLAGIALFAVLIGCVPFATSSGVVLNFVMMALYATLIAQAWNILGGFGGQFSFG
HALFFGTGAYIQAIAQLQGGINAWLALPLAVAGASVVGLFVGALTFRYGLKGSYFALVTL
AFAEVFRIVALSVDFTGGGVGLMVPLRESVSNLQFTTRAGYLRVVLAMVVAALLVTWWLR
NGRFGAYLQAVRDNEDAARAVGVNPFRIKLAAIGISAAFMGAAGAFYVQVFQYIDAGIAY
GSLTSVEALVAAIVGGMGTLWGPVLGAAVLHLLSDLTRNLFGELPGINMVIYGSVLVLIV
IFLPRGIAGLGLSVRQLWNAKGGRHD