Protein Info for GFF1673 in Xanthobacter sp. DMC5

Annotation: Putative alcohol dehydrogenase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 38% identical to ADHX_RABIT: Alcohol dehydrogenase class-3 (ADH5) from Oryctolagus cuniculus

KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 88% identity to xau:Xaut_2610)

MetaCyc: 36% identical to alcohol dehydrogenase class-3 monomer (Homo sapiens)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]; 1.1.1.284 [EC: 1.1.1.284]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

3-methylbutanol biosynthesis (engineered) (6/7 steps found)
ethanol degradation II (3/3 steps found)
ethanolamine utilization (4/5 steps found)
pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
superpathway of anaerobic sucrose degradation (14/19 steps found)
acetaldehyde biosynthesis I (1/1 steps found)
phytol degradation (3/4 steps found)
salidroside biosynthesis (3/4 steps found)
heterolactic fermentation (13/18 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
formaldehyde oxidation II (glutathione-dependent) (2/3 steps found)
ethanol degradation I (1/2 steps found)
pyruvate fermentation to ethanol II (1/2 steps found)
mixed acid fermentation (11/16 steps found)
(S)-propane-1,2-diol degradation (3/5 steps found)
acetylene degradation (anaerobic) (3/5 steps found)
phenylethanol biosynthesis (3/5 steps found)
protein S-nitrosylation and denitrosylation (3/5 steps found)
superpathway of C1 compounds oxidation to CO₂ (8/12 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
serotonin degradation (4/7 steps found)
L-methionine degradation III (1/3 steps found)
pyruvate fermentation to ethanol I (1/3 steps found)
pyruvate fermentation to ethanol III (1/3 steps found)
noradrenaline and adrenaline degradation (8/13 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)
cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
superpathway of N-acetylneuraminate degradation (11/22 steps found)
L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1, 1.1.1.284

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF1673 Putative alcohol dehydrogenase D (Xanthobacter sp. DMC5)
MQIRAAVLRTSPVNKPYADTRPLSVETVQLAPPQAGEVLIKVAAAGLCHSDLSVINGDRP
RQLPMVLGHEAAGVVVETGPGVDDLSAGDHVVMSFVPTCGTCPSCMEGRAQLCGPGQASN
GAGTLLGGGRRLKCDDGTDIYHLCGIAGYGEYAVVSRRSIIKIDKEMSLIDAALFGCAVM
TGVGTVVNTAGVRPGQSVAVVGLGGVGLSAVMGAVAAGADQIVALDLSPQKLDLARQIGA
TDTFLASDPDIVEAVKEATRGGVDHAIEMAGSAPAFELAYKITRRGGTTTTGGLANPNAR
ISLPPVHLVAEERTIKGSYMGSCVPPRDIPRFMALYKRGKLPVNRLLSSTGPLDTINENF
DRLDRGEVVRHVIVY