Protein Info for PS417_08480 in Pseudomonas simiae WCS417
Annotation: elongation factor P
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to EFP_PSEFS: Elongation factor P (efp) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to pfs:PFLU1714)Predicted SEED Role
"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U707 at UniProt or InterPro
Protein Sequence (190 amino acids)
>PS417_08480 elongation factor P (Pseudomonas simiae WCS417) MKTGKELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKL DDVILDRKEATLSFISGDTYTFMDTTDYTMYELNAEDIEAVLPFIEEGMEDVCEAIFFEE RLVSVELPTTIVRKVAYTEGSARGDTSGKVMKPAKLSNGTELQVADFIEIDDLIEIDTRE GGSYKGRAKK