Protein Info for GFF1665 in Xanthobacter sp. DMC5

Annotation: Nitrate import permease protein NrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 93 to 114 (22 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details TIGR01183: nitrate ABC transporter, permease protein" amino acids 72 to 269 (198 residues), 219.8 bits, see alignment E=1.5e-69 PF00528: BPD_transp_1" amino acids 106 to 276 (171 residues), 81.7 bits, see alignment E=2.9e-27

Best Hits

Swiss-Prot: 44% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 95% identity to xau:Xaut_2618)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF1665 Nitrate import permease protein NrtB (Xanthobacter sp. DMC5)
MKSLGVRAGLLSVLLFVAFCALWQVAVTPSASSGPALDPEYAKLMGIATQGAKSAMPGPL
DVAGKLWDNLKRPFYDNGPNDKGLGLQLLYSIGRVFIGYGLAVLVAVPIGFLIGMSPLAY
RALDPFIQVLKPISPLAWMPLALYTIKDSSLSAIFVIFICSVWPMLINTAFGVGAVRKEW
LNVARTLEVGPWRRAFTVILPAAAPTILTGMRISIGIAWLVIVAAEMLVGGTGIGYFVWN
EWNNLSIANVIVGILLIGVVGMALDLILARLQKRVTFPE