Protein Info for GFF1665 in Sphingobium sp. HT1-2

Annotation: Uncharacterized UPF0750 membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 61 to 88 (28 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details PF02588: YitT_membrane" amino acids 32 to 202 (171 residues), 97.7 bits, see alignment E=3e-32

Best Hits

KEGG orthology group: None (inferred from 56% identity to aex:Astex_1552)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF1665 Uncharacterized UPF0750 membrane protein (Sphingobium sp. HT1-2)
MTSIDPTPPAPSPALPVPPAHVARPHSPAEDFYAIAIGCAFIAMGLMLLKQAKLVTGGMA
GIALLLSYLIHLSPATLFLLINIPFFLFAGRAMGMAFGLKTLFANIAIMGVGLAMPYAME
IARISPFFAALFGGSIIGFGILAIARHGAGVGGVGVVALILQKSRGWNAGRTQMACDVLI
LLASLPILNAERFGLSVLSAAAINAVLFVNHRPGRYIGH