Protein Info for GFF1664 in Variovorax sp. SCN45

Annotation: redox proteins related to the succinate dehydrogenases and fumarate reductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 24 to 37 (14 residues), see Phobius details amino acids 422 to 434 (13 residues), see Phobius details amino acids 437 to 438 (2 residues), see Phobius details amino acids 447 to 463 (17 residues), see Phobius details PF01494: FAD_binding_3" amino acids 21 to 212 (192 residues), 30.9 bits, see alignment E=6.3e-11 PF00890: FAD_binding_2" amino acids 23 to 434 (412 residues), 152.1 bits, see alignment E=9.7e-48 PF01266: DAO" amino acids 23 to 216 (194 residues), 48.3 bits, see alignment E=3.9e-16 PF13450: NAD_binding_8" amino acids 25 to 59 (35 residues), 25.2 bits, see alignment 5.9e-09

Best Hits

KEGG orthology group: K00244, fumarate reductase flavoprotein subunit [EC: 1.3.99.1] (inferred from 86% identity to vpe:Varpa_0827)

Predicted SEED Role

"Fumarate reductase flavoprotein subunit (EC 1.3.99.1)" in subsystem Succinate dehydrogenase (EC 1.3.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF1664 redox proteins related to the succinate dehydrogenases and fumarate reductases (Variovorax sp. SCN45)
MTTAPVRTVRRAASLEADAHVSVAIVGGGACGLTAALMLGDAGVDCVVLERDALPGGSTA
LSSGFIPAPGTRTQRAHGVTDDSPARFAADIQAKAHGRAAPVLVEAYADAIGPALDALQA
RHGLEWTLLDGFLYPGHSVHRMHALPQKTGAALMAALQAAVEAAGIPVLTQAVVDALVLD
ADDRVIGIDYLRPDGRHESLGCDALLLACNGFGGNAPMVRALLPEMAEATFGGHAGNDGS
AILWGQALGARLRDLGGYQGHGSWVTPQGALMSWAVMMEGGVQINRDGRRFHDETQGYSE
AAVHVLAQPGGVAWNVFDTPLLALARGFPDFRDAEAAGALRRCESVRELAACIGCDAAVL
QGTLDALRDGAPTTDGRVFARGLDAPYFAVKVTGALFHTQGGLDIAPDMRVLRQDGSPFV
NLLAAGGAAGGVSGDAVWGYLSGNGLLSAVAGGFIAARTAAAFIQSQEASA