Protein Info for GFF1663 in Xanthobacter sp. DMC5

Annotation: Cyanate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21291: CYNS_N
  • amino acids 3 to 72 (70 residues), 46.5 bits, E=2.9e-16
• TIGR00673: cyanase
  • amino acids 5 to 148 (144 residues), 140.8 bits, E=1.6e-45
• PF02560: Cyanate_lyase
  • amino acids 79 to 146 (68 residues), 117.7 bits, E=1.5e-38

Best Hits

Swiss-Prot: 55% identical to CYNS_METPP: Cyanate hydratase (cynS) from Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 99% identity to xau:Xaut_2620)

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

• cyanuric acid degradation II (5/5 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• cyanuric acid degradation I (4/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• allantoin degradation IV (anaerobic) (6/9 steps found)
• uracil degradation III (3/5 steps found)
• superpathway of atrazine degradation (5/8 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Protein Sequence (162 amino acids)

>GFF1663 Cyanate hydratase (Xanthobacter sp. DMC5)
MKREQLTEKLLDIKREKGWTWKYICGEIGGMSPVLVVGALLGQMKLVKPLAKKAAELFGL
SEVEERMLNEVPMRGAGTPMPPTDPLIYRFYELVMVNGPAWKALIEEEFGDGIMSAIDFN
MEMVREPNPKGDRVQITMSGKFLPYKYYGNEQGIPDYGFKES