Protein Info for GFF1663 in Variovorax sp. SCN45

Annotation: Isocitrate lyase (EC 4.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF13714: PEP_mutase" amino acids 7 to 246 (240 residues), 148.5 bits, see alignment E=2.6e-47 PF00463: ICL" amino acids 77 to 182 (106 residues), 55.1 bits, see alignment E=5.3e-19

Best Hits

Swiss-Prot: 43% identical to MMGF_BACSU: 2-methylisocitrate lyase (mmgF) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_0828)

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.30

Use Curated BLAST to search for 4.1.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF1663 Isocitrate lyase (EC 4.1.3.1) (Variovorax sp. SCN45)
MTTDNFKNRLARPDVVLAPGVYDALSALVAEQAGFEALYLSGASIAYTRLGRSDIGLTTF
TEVADTLARITERVRLPVIVDADTGFGNALNTQRTVRGFERAGAAMIQIEDQTFPKRCGH
LDGKAVVPEREMVGKLKAALDARASSDTLILARTDAVAVEGLDAALDRAEAYLACGVDAL
FIEALRSPEQMDAACSRFAHRVPLLANMVEGGKTPIQNADALQKHGFRIAIFPGGTARAV
VHTLQGYYASLHRHRTTQPWRPQMLDFDALNEVIGTPELMRIGKSYGD