Protein Info for GFF1662 in Sphingobium sp. HT1-2

Annotation: Threonine/homoserine exporter RhtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF00892: EamA" amino acids 144 to 271 (128 residues), 60.9 bits, see alignment E=8.5e-21

Best Hits

Swiss-Prot: 51% identical to RHTA_SALTS: Threonine/homoserine exporter RhtA (rhtA) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: None (inferred from 68% identity to gau:GAU_3558)

MetaCyc: 50% identical to L-threonine/L-homoserine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN0-0244

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF1662 Threonine/homoserine exporter RhtA (Sphingobium sp. HT1-2)
MNGQGAVLAGAGAVLASLLSMNMGAAFAKTLFPIVGAYGIAALRIFLAAILLMLFRRPWR
RPIPADVRWPLLIYGATLALMNLLIYQAFARIPLGIAMAIEVTGPLAIVLFGSRRPRDFL
WLGAAVIGLLLLLPLRSDAVLDPLGVIFAVGAAACWALYILTGKRVSGALRGDAVAWGML
AAAILVLPVGLTHAGASLFSPWVLMVGLAIALLSSALPYSLEMEAMRRLPAPVFGLLLSA
APAIGALAGFVVLGERLTALQGVAIFCIIAASGGSALTVRHAPAIEDAPQ