Protein Info for GFF166 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details PF00892: EamA" amino acids 12 to 142 (131 residues), 58.7 bits, see alignment E=4e-20 amino acids 156 to 286 (131 residues), 35 bits, see alignment E=8.3e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to vap:Vapar_5757)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>GFF166 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MTARHLSLPAVKGGLLALLAAALFGISTPLVQHFGKGAGAFTTAALLYAGAAAVGFATRQ
RVEREARMVRGDLPRLLLMAAFGALIGPVALAWGLQHTSGTSASLMLTLEALFTAVLARL
LYQETMDRRVWAAMLLLFAGGVALVLDQGRSGGTQLWGMLAVLVATAAWGVDNTLSRALA
ERDPGQVVLGKAAIGAVAATLLGWLLHEPAPAPAAMVILFTVGATGYGLSLRFYLLAQRA
FGAARTGSVFAFAPFIGAAFAIALGDRSGTWVMAAGGVLMMLGVVLHLIESHGHEHAHER
LAHEHAHRHDDGHHDHTHEVMPSGAHSHPHVHEPFRHAHAHVPDAHHRHAH