Protein Info for GFF1659 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Flagellar protein FlhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF06366: FlhE" amino acids 28 to 130 (103 residues), 144 bits, see alignment E=7.9e-47

Best Hits

Swiss-Prot: 100% identical to FLHE_SALTY: Flagellar protein FlhE (flhE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03516, flagellar protein FlhE (inferred from 99% identity to spq:SPAB_01248)

Predicted SEED Role

"Flagellar protein FlhE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>GFF1659 Flagellar protein FlhE (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRKWLALLLFPLTVQAAGEGAWQDSGMGVTLNYRGVSASSSPLSARQPVSGVMTLVAWRY
ELNGPTPAGLRVRLCSQSRCVELDGQSGTTHGFAHVPAVEPLRFVWEVPGGGRLIPALKV
RSNQVIVNYR