Protein Info for GFF1658 in Xanthobacter sp. DMC5

Annotation: Aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF00696: AA_kinase" amino acids 3 to 231 (229 residues), 163.8 bits, see alignment E=1.1e-51 TIGR00656: aspartate kinase, monofunctional class" amino acids 4 to 415 (412 residues), 413.1 bits, see alignment E=1.3e-127 TIGR00657: aspartate kinase" amino acids 63 to 415 (353 residues), 369.5 bits, see alignment E=2.8e-114 PF01842: ACT" amino acids 281 to 339 (59 residues), 48.1 bits, see alignment E=1.5e-16 PF22468: ACT_9" amino acids 284 to 338 (55 residues), 43.6 bits, see alignment 4e-15 amino acids 357 to 413 (57 residues), 78.1 bits, see alignment 6.7e-26 PF13840: ACT_7" amino acids 353 to 413 (61 residues), 49.6 bits, see alignment E=5.6e-17

Best Hits

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 92% identity to xau:Xaut_2625)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>GFF1658 Aspartate kinase (Xanthobacter sp. DMC5)
MARLVMKFGGTSVANIERIRNVARHVKREVEAGYKVAVVVSAMSGKTNELVAWCKDASSL
YDAREYDAVVASGEQVTSGLLAIALQEMGVSARSWQGWQIPISTDDAHGSARIMDIDADR
LATSIEGGEVAVIAGFQGMHLPTGRITTLGRGGSDTSAVAVAAALKAERCDIYTDVDGVY
TTDPRVVPKARRLDRIAFEEMLEMASLGAKVLQVRSVELAMVHNVRTFVRSSLVDPDAPE
MREVEKAGTLICDEEEIVASQMESQVVTGIAFSKDEAQVSIRRVADKPGIAAAVFGPLAD
AHINVDMIVQNVSADGYTDITFTVPTADFERAKAVIERARDSIAFQAIEGAGDVTKVSVI
GIGMRSHAGVAAKAFEALAGRGINIRAITTSEIKISFLIDAAYTELAVRTLHSLYGLDS