Protein Info for GFF1656 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 40 to 295 (256 residues), 274.3 bits, see alignment E=4.8e-86 PF03480: DctP" amino acids 42 to 321 (280 residues), 284.1 bits, see alignment E=6.4e-89

Best Hits

Swiss-Prot: 33% identical to DCTP_CHRSD: Solute-binding protein Csal_2479 (dctP) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: None (inferred from 54% identity to vap:Vapar_3326)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>GFF1656 TRAP-type C4-dicarboxylate transport system, periplasmic component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKHTTINPWRRAFVSLAAGAALFGAVAAQAQDVKERTLRFAFSLAQDHPLGTGAKKFADA
VAQKSGGKMKVALFPGAVLGSDPQNLSAIRGGTLDFTSMATGLVASIDKQQMVFDLPFLF
NNAQEAYAIADGPVGRRLMDDLAPHGVIGLGVWDLGFRHLTNSRRPIARQEDIQGLKIRV
IASPIFIDLFTTLGANPVPMTFGELYGALESRTVDGQDNPLGVIESAKFAEVQKFLSLSR
HVYTGMPLLMSKKTWDGMSETERRIIRESAEEAKKLQREATQAKEAQAIDGLKKTMQVNE
VAAPELARLRQKVQPVVDKFSREVGEATYKQVAEELARMRAGK