Protein Info for GFF1653 in Xanthobacter sp. DMC5

Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 21 to 251 (231 residues), 194.4 bits, see alignment E=1e-61 PF02348: CTP_transf_3" amino acids 22 to 232 (211 residues), 147.9 bits, see alignment E=4e-47 PF12804: NTP_transf_3" amino acids 35 to 147 (113 residues), 36 bits, see alignment E=8.2e-13

Best Hits

Swiss-Prot: 85% identical to KDSB_AZOC5: 3-deoxy-manno-octulosonate cytidylyltransferase (kdsB) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 85% identity to azc:AZC_0137)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>GFF1653 3-deoxy-manno-octulosonate cytidylyltransferase (Xanthobacter sp. DMC5)
MPADTPSPAPAPKGRQAGRVLVLIPARMAATRLPGKPLADVGGRPMIVEVARRAVAAGIG
RVAVATDAPEIAAAVTAAGLEAVMTRSDHPSGSDRIFEALTTLDPVGEVEIVVNVQGDLP
TILPNTIRTALIPLLETSADIATLAAEITLAEERTDPNVVKVVGSPLAPGLLRALYFTRA
TAPFGEGPLYHHIGLYAYRRAALERFVSLPPSPLEKREKLEQLRALEAGMRIDVAVVDAV
PLGVDTPSHLERARALLAQEK