Protein Info for GFF1652 in Sphingobium sp. HT1-2

Annotation: Glutaminase (EC 3.5.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR03814: glutaminase A" amino acids 7 to 305 (299 residues), 413.6 bits, see alignment E=2.1e-128 PF04960: Glutaminase" amino acids 21 to 305 (285 residues), 381.4 bits, see alignment E=1.3e-118

Best Hits

Swiss-Prot: 72% identical to GLSA_SPHWW: Glutaminase (glsA) from Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)

KEGG orthology group: K01425, glutaminase [EC: 3.5.1.2] (inferred from 89% identity to sch:Sphch_0646)

Predicted SEED Role

"Glutaminase (EC 3.5.1.2)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF1652 Glutaminase (EC 3.5.1.2) (Sphingobium sp. HT1-2)
MDLTALIDDIVAAMAKETERGTVASYIPELAKVDVGQFGIAIATADGRLLTGGDADTGFS
IQSISKVFALTLALGKVGDQLWDRVGREPSGNAFNSIVQLEQEHGIPRNPFINAGAIVVA
DVNLGGHQPRVAIGEMLRFVRYLAGDDAIRINEEVAASETATGYRNMALANYMRAFNNVR
HPVDLVLGSYFHQCAIEMNCRQLALAGRYLMLDGRHPEGGRVVSPSRARRINALMLTCGH
YDASGDFAFRVGIPGKSGVGGGILAIVPGRAAIAVWSPGLNASGNSALGTKALEMLARRT
GWSVFSPPEVHQG