Protein Info for GFF1651 in Sphingobium sp. HT1-2

Annotation: Inner membrane protein, KefB/KefC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 234 to 266 (33 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 354 to 368 (15 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 25 to 390 (366 residues), 147.9 bits, see alignment E=3.9e-47 PF02254: TrkA_N" amino acids 421 to 533 (113 residues), 91.9 bits, see alignment E=3.5e-30

Best Hits

KEGG orthology group: K03455, monovalent cation:H+ antiporter-2, CPA2 family (inferred from 88% identity to sjp:SJA_C1-21560)

Predicted SEED Role

"putative Glutathione-regulated potassium-efflux system protein KefB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (594 amino acids)

>GFF1651 Inner membrane protein, KefB/KefC family (Sphingobium sp. HT1-2)
MTDAINPQSFSDSLVILGAAGLVIPGFARFRISPVIGFILVGLAVGPAGLGSLVGQYPWL
YHVTISNRAAIEPFAELGVILLLFSIGLELSFRRLWSMRAQVFGVGATELLGSAALIAMG
LYLLGQPTAGAIGLGLALALSSTAVVLPMVGTQSAVGRSAFSMLLFEDLALVPIIFMLGA
LAPSVATSPDAAWNELATTLLKGGLTIAVMLVFGRIFLPHIFRQAARTKSPEVFLAASLL
VVILSSLATSIAGLSPIVGALLAGLLIAETDYHGEVEVMTAPFKGLALGVFLITVGMSLD
LRVILANWPSLLLAVLGVVVAKTLVTGLLLYFSGVRKGVALEVGVLMSSPSETTLIVLSA
AAAAKLILPSTAAFWQIVTAIGLTITPLLARFGHDIAQRLENAIGEERVENEPDQTEAAA
VVIGFGRVGQMVCDLLKTHGQRFIVVESDPDVVAEARRLGYPILFGDVARAEMLDRLRLG
HARALILTMDDPVLSVRVTKRVRGWVPDLPIIARARDADHAAQLYKAGASDAVPETLESS
LQLAETALVDLGVAMGPVIASIHQAREDLRVGIKEAAQLQSAPRLRRLRQDEVP