Protein Info for PS417_08395 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 836 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 265 to 287 (23 residues), see Phobius details amino acids 308 to 334 (27 residues), see Phobius details amino acids 353 to 379 (27 residues), see Phobius details amino acids 399 to 417 (19 residues), see Phobius details amino acids 423 to 446 (24 residues), see Phobius details amino acids 470 to 494 (25 residues), see Phobius details amino acids 712 to 733 (22 residues), see Phobius details amino acids 765 to 788 (24 residues), see Phobius details amino acids 800 to 820 (21 residues), see Phobius details PF02687: FtsX" amino acids 266 to 375 (110 residues), 39.3 bits, see alignment E=3.2e-14 amino acids 717 to 824 (108 residues), 29.2 bits, see alignment E=4.2e-11

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 98% identity to pfs:PFLU1697)

Predicted SEED Role

"FIG00809136: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZJ4 at UniProt or InterPro

Protein Sequence (836 amino acids)

>PS417_08395 ABC transporter permease (Pseudomonas simiae WCS417)
MARLPLLRLFSLAMRQLLRDARAGELRVLFFALLVAVAASTAIGYFGARLNGAMLLRATE
FLGADLVLEGSSPARPEQIRSGTELGLDHARIVEFSSVIATDNGIQLSSIKAVNEQYPLR
GELKSAAAPFGAETPGGGPKPGEAWVEARLLTALDLKVGDSIDVGMKTLRLARVLTYEPD
RAGNFYSLTPRVMINLADLDATGVVQPGSRVSYRELWRGPQGSTVLQTYRDLVKPGLAAN
QRLQDSRDGNQQIGGALGKAERYLNMASLVAVLLAGVAVALSANRFATRRFDASALLRCL
GLSRREAMLLFSLQLSVLGLLASLTGAVLGWLAQFGLFYFLHDLLPADVPPGGLLPAIAG
IGTGLVALAGFALPPLAALGRVPPLRVLRRDMLPIPSSTWMVYGAALFALGLIMWRLSLD
LVLTFALLGGGVVAALILGGLLLLLLQSLRRLLARASLPWRLGLGQLLRHPLAAAGQSLA
FGLILLSMGLIALLRGELLDTWQNQLPKDAPNYFALNILPADKDAFGARLLELQAQSAPL
YPVVPGRLISINGEPVQEIVSKDSSGDRAVQRDLSLTWAAELPPGNALTAGSWWSQQPTD
EVPGVSVEAKVAESLKLKLDDHLVFTVGGENREARVTSLRTINWDNFQPNFFMIFQPGTL
KDLPTTYLTSFYLAPGHDQQIVDLSRAFPAVTILQVEALLEQLRSILAQVTLAVEYVLLF
VLAAGMAVLFSGLQATLDERIRQGALLRALGAERKLLVKARRIEFGLLGAVSGLLAALGT
ELVTFVLYRYAFDLAWQPHPWLLLLPVIGAVLIGGAGVFGTRRALNASPLTVLREG