Protein Info for GFF1648 in Xanthobacter sp. DMC5

Annotation: Inner membrane ABC transporter permease protein YejB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 172 to 199 (28 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 286 to 313 (28 residues), see Phobius details amino acids 333 to 358 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 156 to 363 (208 residues), 110.7 bits, see alignment E=3.8e-36

Best Hits

Swiss-Prot: 64% identical to YEJB_ECO57: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli O157:H7

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 94% identity to xau:Xaut_2634)

MetaCyc: 64% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>GFF1648 Inner membrane ABC transporter permease protein YejB (Xanthobacter sp. DMC5)
MLAYIVRRIALMVPTILGIMLVSFVVIQFAPGGPVERVIAQLTGEDVSATSRVSGGGSDF
SGAGAAAQAGAAAEMSSKYRGAQGLDPAFIKELEKQFGFDKPPHERFLKMITDYATFNFG
KSYFRDISVLELIGEKMPVSISLGLWMTLITYLISIPLGIGKAMRDGSRFDVWTSAVIIV
GYAIPSFLFAILLIILFAGGSFLDLFPLRGLTSENFWQMSWPERIADYAWHLVLPLTSMV
LGAFATMTLLTKNSFLEEIRKQYVTTARMKGLSESRVLYGHVFRNAMLIVIAGFPSAFIA
AFFSGSLLIETIFSLDGLGLLGFESVLNRDYPVVFATLYIFSLAGLIVGLISDLTYMLVD
PRIDFETREV