Protein Info for GFF1646 in Sphingobium sp. HT1-2

Annotation: Cytidylate kinase (EC 2.7.4.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF02224: Cytidylate_kin" amino acids 3 to 201 (199 residues), 181.2 bits, see alignment E=1.2e-57

Best Hits

Swiss-Prot: 55% identical to KCY_RHOP2: Cytidylate kinase (cmk) from Rhodopseudomonas palustris (strain HaA2)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 90% identity to sch:Sphch_0650)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>GFF1646 Cytidylate kinase (EC 2.7.4.25) (Sphingobium sp. HT1-2)
MIIAVDGPAASGKGTIAKALGRHYGLPVLDTGLLYRAVGLSVLKKGGDPDHQADALAACG
FDDAILADPALRSEAVGSLASRVSVHQSVRDALVQRQRDFATQPGGAILDGRDIGTVIAP
DADAKIFVTASVHVRAERRFKDAEAHGGEPDMDSLIADIQARDTRDMSRDHAPLKVADGA
DLLDTSNLTIDAAVQRAIALVDAQLEGRP