Protein Info for GFF1644 in Xanthobacter sp. DMC5

Annotation: putative ABC transporter ATP-binding protein YejF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 PF00005: ABC_tran" amino acids 28 to 187 (160 residues), 103.2 bits, see alignment E=6.2e-33 amino acids 305 to 456 (152 residues), 96.8 bits, see alignment E=6.2e-31 PF08352: oligo_HPY" amino acids 238 to 268 (31 residues), 27.6 bits, see alignment (E = 1.1e-09) amino acids 507 to 538 (32 residues), 18.5 bits, see alignment (E = 7.7e-07)

Best Hits

Swiss-Prot: 59% identical to YEJF_ECOLI: Uncharacterized ABC transporter ATP-binding protein YejF (yejF) from Escherichia coli (strain K12)

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 88% identity to xau:Xaut_2636)

MetaCyc: 59% identical to putative oligopeptide ABC transporter ATP binding subunit YejF (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>GFF1644 putative ABC transporter ATP-binding protein YejF (Xanthobacter sp. DMC5)
MTTPLLSVRDLSVAFRRGDGAPPALAVKTVSFELAKGETLALVGESGSGKSVTALSVLKL
LPYPSASHPSGEILFKGRDLLTVSERELRGIRGNNITMVFQEPMSSLNPLHTIERQVGEM
LILHRGMSAHAARARTLELLAEVGIPQPEERLSAYPHQLSGGQRQRVMIAMALANEPDLL
IADEPTTALDVTVQAQILKLLKELQARLGMAMLFITHDLGIVRKIADRVCVMQKGEIVEQ
GGAEETFQHPRHPYTQALLKAEPKPDPAPIAPDAPLVMEANDLKVYFPIKRGILRKTVGH
VKAVDGVSIAIRRGETLGVVGESGSGKTTLGLALLRLISSAGPIAFLGKPIDALSFKAMR
PLRSDLQIVFQDPFGALSPRMSVAEIVGEGLLVHQRQLSADERDARVVAALADVGLDPET
RHRYPHEFSGGQRQRISIARAMALEPSFVVLDEPTSALDMIVQAQIVDLLRALQKKRDLT
FMFISHDLRVVSALASRILVMRNGKMVEEGPAHDVFEHPKEDYTRALFAAAFNLDATGHG
VVRQ