Protein Info for GFF1637 in Sphingobium sp. HT1-2

Annotation: Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF00042: Globin" amino acids 30 to 134 (105 residues), 45.8 bits, see alignment E=4.2e-16

Best Hits

Swiss-Prot: 48% identical to Y211_AQUAE: Uncharacterized globin-like protein aq_211 (aq_211) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K05916, nitric oxide dioxygenase [EC: 1.14.12.17] (inferred from 77% identity to sch:Sphch_0658)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.17

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>GFF1637 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (Sphingobium sp. HT1-2)
MRENLSPETIAIVKATGPALRRHGVEITTRMYARLFEDASIKDMFDQAAQASGEQPRRLA
AAILGFAENVDKLQALDGAIARMVQRHVDTGVQPDHYPKVAAALLPAIREVLGEAVATDE
VLAAWAEAYGFLADILIGKEQAAYAQAA